PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa10g001630.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family BBR-BPC
Protein Properties Length: 351aa    MW: 39257 Da    PI: 8.8762
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa10g001630.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind48.24.3e-1538138184
       GAGA_bind   1 mdddgsre..rnkg.yye................paaslkenlglqlmssiaerdakirernlalsekkaavaerdmaflqrdkalaernkalve 76 
                     m++ g++e  r+k+ +y+                ++++l   ++ ++ms++ae+da+++e+n a+++kk+a+a+rd+a+ qrdkal+er++a++e
  Csa10g001630.1  38 MESVGQYEngRFKPdHYKgtqsvwnmtpqhqikeQHNALV--MNRKIMSILAEKDAAVKEKNEAVAAKKEALAARDEALEQRDKALSERDNAIME 130
                     6777777767888888888888888888776654446666..99*************************************************** PP

       GAGA_bind  77 rdnkllal 84 
                     r+++l   
  Csa10g001630.1 131 RESALKCS 138
                     ***98654 PP

2GAGA_bind154.42e-47142250149259
       GAGA_bind 149 kkkkrqrakkpkekkakkkkkksekskkkvkkesaderskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyP 243
                     ++++ q++++ k+  ++k+k+ +++ +++ +++++  +s+++++s d++ln v++De+t+PvP+C+CtG+ rqCYkWG GGWqS+CCttt+S+yP
  Csa10g001630.1 142 QHETDQKEERGKQGARSKAKRVGDDLNRQAASPGM--KSRKDWDSNDVGLNLVTYDEATMPVPMCTCTGTARQCYKWGHGGWQSSCCTTTLSQYP 234
                     45566777888888888999999999999999995..6********************************************************* PP

       GAGA_bind 244 LPvstkrrgaRiagrK 259
                     LP+++++r++Ri+grK
  Csa10g001630.1 235 LPQMPNKRHSRIGGRK 250
                     ***************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012263.7E-7838250IPR010409GAGA-binding transcriptional activator
PfamPF062177.2E-760133IPR010409GAGA-binding transcriptional activator
PfamPF062171.1E-43143250IPR010409GAGA-binding transcriptional activator
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MMFNESRNSN KGSDKLITNV FDHFGHCSVL FLFQVSKMES VGQYENGRFK PDHYKGTQSV  60
WNMTPQHQIK EQHNALVMNR KIMSILAEKD AAVKEKNEAV AAKKEALAAR DEALEQRDKA  120
LSERDNAIME RESALKCSSI PQHETDQKEE RGKQGARSKA KRVGDDLNRQ AASPGMKSRK  180
DWDSNDVGLN LVTYDEATMP VPMCTCTGTA RQCYKWGHGG WQSSCCTTTL SQYPLPQMPN  240
KRHSRIGGRK NERRTTGLGT APTATSLSSS LNIWATVEEE ECVNNNNSSA GKSGNEESKE  300
NNCERLAIVV DDMDREKCNG KVLENKTSNS KLKRTVSFPM HSQVRSCRTR *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF6336031e-117EF633603.1 Cardamine pratensis GAGA-motif binding transcriptional activator (BBR/BPC5) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010431840.11e-139PREDICTED: LOW QUALITY PROTEIN: protein BASIC PENTACYSTEINE5-like
SwissprotQ8S8C61e-110BPC4_ARATH; Protein BASIC PENTACYSTEINE4
TrEMBLV4M9X71e-123V4M9X7_EUTSA; Uncharacterized protein
STRINGfgenesh1_pm.C_scaffold_70000681e-117(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40902659
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G21240.22e-90basic pentacysteine 4